PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.7867s1140.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family GATA
Protein Properties Length: 307aa    MW: 34216.9 Da    PI: 4.8428
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.7867s1140.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.51.6e-17196230135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Bostr.7867s1140.1.p 196 CLHCATEKTPQWRTGPMGPKTLCNACGVRYKSGRL 230
                          99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.6E-1031286IPR016679Transcription factor, GATA, plant
SuperFamilySSF577162.66E-15189252No hitNo description
PROSITE profilePS5011412.044190226IPR000679Zinc finger, GATA-type
SMARTSM004016.7E-17190240IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.2E-14193228IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.04E-14195242No hitNo description
PfamPF003202.6E-15196230IPR000679Zinc finger, GATA-type
PROSITE patternPS003440196221IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MERLTSELFL VAGNADSFVV DDLLDFSNDD GQIDDGFDTL LPDSSTVTLT DSSNSSSLFT  60
DGTGFSDDLC VPSEDLAELE WLSNFVEESF SKEDQDKLHL LSGLKNHQST GSTQTHQIKP  120
EPEPEFDQFI DTDESNVAVP AKARSKRSRS AASTWASRLL SLAGFDESNP RKKQHIIKEQ  180
DIAGEMDVDC GGGRRCLHCA TEKTPQWRTG PMGPKTLCNA CGVRYKSGRL VPEYRPASSP  240
TFVMARHSNS HRKVMELRRQ KEMRDDHLLS QLRCENLPMD ITSNGEDFLI HNNNNNHVAP  300
DFRHLI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00048PBMTransfer from AT4G32890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1171690.0AK117169.1 Arabidopsis thaliana At4g32890 mRNA for unknown protein, complete cds, clone: RAFL16-71-E16.
GenBankBT0083420.0BT008342.1 Arabidopsis thaliana At4g32890 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002869237.10.0zinc finger family protein
SwissprotO826320.0GATA9_ARATH; GATA transcription factor 9
TrEMBLD7M9N00.0D7M9N0_ARALL; Zinc finger family protein
STRINGfgenesh2_kg.7__840__AT4G32890.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56822749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.11e-169GATA transcription factor 9